Cell cycle arrest enhances CD8+ T cell effector function by potentiating glucose metabolism and IL-2 signaling
Floortje J. van Haften, Tetje C. van der Sluis, Hanna S. Hepp, Nils Mülling, Reza Nadafi, Bharath Sampadi, Suzanne van Duikeren, J. Shirin Mostert, Rosemarijn van der Sterre, Peter A. van Veelen, Graham A. Heieis, Dominique M. B. Veerkamp, Thomas H. Wesselink, Ward Vleeshouwers

TL;DR
Stopping CD8+ T cells from dividing boosts their energy and ability to fight cancer, improving immunotherapy outcomes.
Contribution
Transient cell cycle arrest reprograms CD8+ T cells to enhance their metabolic state and antitumor function.
Findings
Cell cycle-arrested CD8+ T cells undergo metabolic reprogramming into a highly energized state.
Enhanced glycolysis and IL-2 signaling support rapid proliferation and tumor control after release from arrest.
Transient arrest improves CD8+ T cell efficacy in immunotherapy models like checkpoint blockade and adoptive transfer.
Abstract
Cell cycle-inhibiting chemotherapeutics are widely used in cancer treatment. Although the primary aim is to block tumor cell proliferation, their clinical efficacy also involves specific effector CD8+ T cells that undergo synchronized proliferation and differentiation. How CD8+ T cells are programmed when these processes are uncoupled, as occurs during cell cycle inhibition, is unclear. Here, we show that activated CD8+ T cells arrested in their cell cycle can still undergo effector differentiation. Cell cycle-arrested CD8+ T cells become metabolically reprogrammed into a highly energized state, enabling rapid and enhanced proliferation upon release from arrest. This metabolic imprinting is driven by increased nutrient uptake, storage and processing, leading to enhanced glycolysis in cell cycle-arrested cells. The nutrient sensible mTORC1 pathway, however, was not crucial. Instead,…
Genes, proteins, chemicals, diseases, species, mutations and cell lines named across the full text — each resolved to its canonical identifier and authoritative record.
Click any figure to enlarge with its caption.
Figure 10
Figure 11
Figure 12
Figure 13
Figure 14
Figure 15
Figure 16
Figure 17
Figure 1
Figure 2
Figure 3
Figure 4
Figure 5
Figure 6
Figure 7
Figure 8
Figure 9- —https://doi.org/10.13039/501100004622KWF Kankerbestrijding (Dutch Cancer Society)
- —https://doi.org/10.13039/501100005039Leids Universitair Medisch Centrum (Leiden University Medical Center)
- —https://doi.org/10.13039/501100003246Nederlandse Organisatie voor Wetenschappelijk Onderzoek (Netherlands Organisation for Scientific Research)
Peer Reviews
No public reviews on file for this paper yet. If you reviewed it on a platform where reviews are public (OpenReview, ICLR, NeurIPS, ICML), you can paste yours below so the community can read it here.
Videos
No videos yet. Explain this paper in a talk, walkthrough, or lecture? Add one.
Taxonomy
TopicsCancer Immunotherapy and Biomarkers · CAR-T cell therapy research · Phagocytosis and Immune Regulation
Main
Upon encountering cognate antigens, naive CD8^+^ T cells initiate a tightly regulated program of clonal expansion and differentiation to generate effector T cells that are central to antiviral and antitumor immunity^1^. This process involves rapid proliferation and acquisition of cytolytic function, including perforin-mediated and granzyme-mediated killing and production of inflammatory cytokines such as interferon gamma (IFNγ) and tumor necrosis factor (TNF), which are essential for pathogen clearance and tumor control. A key early component of this response is the autocrine and paracrine production of interleukin (IL)-2, which acts as a critical driver of T cell proliferation and effector differentiation by supporting expansion of antigen-specific clones and promoting the survival of effector T cells through STAT5 signaling^2–5^.
The magnitude and quality of the CD8^+^ T cell response dictate the formation of a competent pool of effector T cells, capable of trafficking into peripheral tissues and infiltrating the tumor microenvironment (TME), where they must overcome antigenic persistence, metabolic constrains and suppressive signals^6,7^. Recent advances have uncovered key transcriptional and metabolic programs that govern CD8^+^ T cell activation and differentiation. For instance, single-cell RNA sequencing has revealed dynamic transcriptional programs that guide naive CD8^+^ T cells through distinct differentiation states, from early activated to terminally differentiated effector cells. These transitions are regulated by key transcription factors, such as ID2, T-bet, Eomes and Blimp-1, which balance effector function and memory formation^8^. Concurrently, metabolic reprogramming, particularly the shift toward glycolysis, enhanced mitochondrial biogenesis and lipid metabolism, enables the bioenergetic demands of clonal expansion and effector differentiation^9^. Within the TME, however, persistent antigen exposure and inhibitory cues such as signaling by programmed death-1 (PD-1) and its ligand PD-L1 drive T cell exhaustion, impairing cytotoxicity and proliferative capacity^10^. The therapeutic potential of enhancing CD8^+^ T cell responses has been highlighted by advances in immunotherapy. Immunotherapies including checkpoint blockade, adoptive T cell transfer and neoantigen-targeted vaccines seek to reinvigorate or amplify CD8^+^ T cell responses, underscoring the therapeutic importance of understanding how T cells integrate proliferative and functional cues^11^.
Cell cycle-inhibiting chemotherapeutics are widely used in cancer treatment for their ability to curb tumor cell proliferation. However, emerging data suggest that the clinical efficacy of these agents often depends on the activity of effector CD8^+^ T cells, rather than solely on direct cytotoxic effects against tumor cells^12–14^. The fundamental question that arises from experimental and clinical settings in which cell cycle inhibitors are used is how programming of CD8^+^ T cells develops when proliferation and differentiation are decoupled as occurs during cell cycle arrest^7,15^.
Here, we show that transient uncoupling of cell cycle progression from differentiation enables CD8^+^ T cells to acquire metabolic features that enhance their proliferation and effector function. These traits bolster the efficacy of various T cell-mediated immunotherapies, revealing an unappreciated layer of regulation in CD8^+^ T cell biology. Our findings suggest that controlled modulation of cell cycle dynamics could be leveraged to improve the design and efficacy of immunotherapeutic interventions.
Results
Enhanced CD8+ T cell proliferation after temporal cell cycle inhibition
To uncouple CD8^+^ T cell proliferation from differentiation, we developed a reductionistic assay that allowed strict control of cell cycle progression (Fig. 1a). Human and mouse CD8^+^ T cells were activated with CD3 and CD28 agonistic antibodies ex vivo to mimic antigenic stimulation. After activation, the CD8^+^ T cells were allowed to experience normal cell cycle progression (non-arrested setting), or were ‘arrested’ using cell cycle inhibitors that acted in distinct phases of the cell cycle; that is, hydroxyurea (HU), which arrests cells in S phase^16^, the cyclin-dependent kinase 1 (CDK1) inhibitor RO-3306 (ref. ^17^), which inhibits G2-to-M progression, the topoisomerase I inhibitor topotecan, which arrests cells in G1 phase^18^, and the CDK4/CDK6 inhibitors ribociclib and palbociclib, which prevent G1-to-S progression^19^ (Fig. 1b). As expected, all inhibitors effectively arrested the cell cycle of mouse and human CD8^+^ T cells after activation (Fig. 1c,d and Extended Data Fig. 1a). Next, cell cycle arrest was terminated by removal of the inhibitor, thereby permitting CD8^+^ T cells to undergo cell cycle progression after initial blockade (hereafter named ‘released’ CD8^+^ T cells). Released CD8^+^ T cells displayed an increase in cell division when compared to non-arrested cells that proliferated the same time, as visualized by cell proliferation tracing dyes and by determining the percentage of dividing cells and calculating the average number of cell divisions (division index) of non-arrested and released conditions (Fig. 1c–e and Extended Data Fig. 1a). Enhanced proliferation of released CD8^+^ T cells was observed for all tested inhibitors, indicating that this effect was neither drug specific nor restricted to inhibition of a particular phase of the cell cycle. HU consistently provided the best overall CD8^+^ T cell survival compared to other cell cycle inhibitors (Extended Data Fig. 1b).Fig. 1. Enhanced CD8^+^ T cell proliferation and effector function after temporal cell cycle inhibition.a, Experimental setup. Experiments were performed with isolated CD8^+^ T cells derived from peripheral blood mononuclear cells from healthy donors or from splenocytes of naive mice. b, Schematic overview of cell cycle inhibition with different cell cycle inhibitors. c, Representative proliferation plots of unstimulated human CD8^+^ T cells, or ex vivo-stimulated human CD8^+^ T cells that were left untreated (non-arrested), arrested in the cell cycle using RO-3306 or ribociclib (arrested) or released from cell cycle arrest (released). d, Representative proliferation plots of unstimulated and ex vivo-stimulated human and mouse CD8^+^ T cells under the same conditions as in c, treated with HU. e, Percentage of proliferating cells and division index (mean ± s.e.m.) of ex vivo-stimulated human (n = 8) and mouse (n = 7) CD8^+^ T cells that were left untreated (non-arrested) or released after HU arrest. f, Expression (geometric mean fluorescence intensity (gMFI) ± s.e.m.) of ID2 (left, n = 4 mice) and granzyme B (right, n = 6 mice) in unstimulated and ex vivo-stimulated mouse CD8^+^ T cells that were left untreated (non-arrested), arrested with HU or released from HU-induced arrest. g, Representative histograms of CD69, CD62L, CD127, CXCR3, EOMES, PD-1 and LAG-3 expression in ex vivo-stimulated mouse CD8^+^ T cells treated temporally with HU or left untreated. h, Naive mice were vaccinated with E7 SLP/CpG on day 0 and treated with HU for 4 consecutive days (n = 5) or left untreated (n = 6). Left, percentages of circulating E7_49–57_-specific CD8^+^ T cells over time (mean ± s.e.m.). Middle, normalized response relative to the peak. Right, percentages of KLRG1^+^CD44^+^ CD8^+^ T cells over time (mean ± s.e.m.). i, Slope of the E7_49–57_-specific CD8^+^ T cell response depicted in h. Statistical comparisons were performed with two-sided paired t-test (e), repeated-measures analysis of variance (ANOVA) with Sidak’s multiple-comparison test (f) or two-sided unpaired t-test (h and i); P values are shown on the graphs.
The enhanced proliferation after transient arrest suggested altered CD8^+^ T cell differentiation. Therefore, we examined key effector markers. ID2 expression was induced in both arrested and non-arrested cells and further increased after release (Fig. 1f). Arrested cells initially showed low granzyme B, but upregulated it strongly upon release, exceeding levels in non-arrested cells (Fig. 1f). While CD62L and CD127 were only modestly reduced, arrested cells upregulated CD69 (Fig. 1g and Extended Data Fig. 1c–e). EOMES was induced during arrest and further increased after release, paralleling granzyme B and CXCR3 expression. PD-1 and LAG-3 were moderately upregulated during arrest, with higher expression in non-arrested and released cells (Fig. 1g and Extended Data Fig. 1c,d). Arrested cells also exhibited blast formation, although less prominently than non-arrested or released cells (Extended Data Fig. 1f–h).
We next assessed the impact of temporal cell cycle arrest on CD8^+^ T cell responses in vivo by vaccinating mice with the HPV16 E7_43–63_ long peptide in combination with HU or topotecan treatment. Although E7-specific CD8^+^ T cell responses were initially lower in cell cycle inhibitor-treated mice, the peak response exceeded that of untreated vaccinated mice (Fig. 1h, Extended Data Fig. 2a and Supplementary Fig. 1). This reflected a steeper expansion of vaccine-induced CD8⁺ T cells following the blockade (Fig. 1h,i and Extended Data Fig. 2a), suggesting that cell cycle arrest programmed cells for rapid proliferation. The expansion effect was also evident in circulating KLRG1^+^ CD8^+^ T cells, marking antigen-reactive effector cells (Fig. 1h and Extended Data Fig. 2a)^20^. Total CD8^+^ T cell numbers were unaffected, indicating a specific effect on proliferating antigen-specific cells (Extended Data Fig. 2b). Despite enhanced expansion, CD8^+^ T cells did not display traits of exhaustion, as PD-1 expression remained unaltered over time (Extended Data Fig. 2c). Together, these data indicate that enforced cell cycle arrest promotes differentiation of CD8^+^ T cells into effector cells with enhanced proliferative capacity.
Altered metabolism and differentiation during cell cycle arrest
To interrogate the mechanisms underlying enhanced cell cycle progression after temporal cell cycle arrest, we characterized the transcriptional activity in unstimulated, arrested, released and non-arrested CD8^+^ T cells. Gene expression profiling showed that all four conditions showed distinct transcriptomic profiles, indicated by their segregation in principal component analysis (q < 0.05; Fig. 2a). From the transcriptome dataset, significant differentially expressed genes were selected (q < 0.05) and ingenuity pathway analysis (IPA) was performed to characterize the underlying molecular pathways. Differentially regulated pathways included cell cycle regulation (G1/S checkpoint regulation), cellular metabolism (for example, glycolysis, cholesterol biosynthesis) and T cell-specific differentiation (for example, type 1/2 helper T (T_H_1/T_H_2) pathway; Fig. 2b and Extended Data Fig. 3a). Based on these results, we performed gene-set enrichment analysis (GSEA) of Molecular Signatures Database (MSigDB) hallmark gene sets including cell cycle regulation (G2M checkpoint), metabolic pathways (that is, glycolysis, cholesterol biosynthesis, oxidative phosphorylation, fatty acid metabolism) and signaling pathways (IL-2–STAT5, MTORC1, PI3–AKT–MTOR signaling; Fig. 2c,d and Extended Data Fig. 3b,c). The metabolism-related gene sets were particularly upregulated in released CD8^+^ T cells, indicating that released cells adjusted their cellular metabolism.Fig. 2. Cell cycle arrest induces transcriptional remodeling of CD8^+^ T cell metabolism.Transcriptomic analysis of unstimulated mouse CD8^+^ T cells, or ex vivo-stimulated mouse CD8^+^ T cells that were left untreated (non-arrested), arrested in the cell cycle using HU or released from HU-induced arrest (released; n = 4). a, Three-dimensional principal component analysis plot. b, IPA of differentially expressed genes (FDR < 0.05) comparing arrested to released cells. The top five significantly enriched pathways with the most positive and negative z-scores are shown. Statistical analysis was performed using two-sided unpaired t-test with Benjamini–Hochberg correction. c, Normalized enrichment scores (NES) of eight selected mouse hallmark gene sets (from MSigDB; FDR < 0.05) based on GSEA. d, GSEA enrichment plots after GSEA analysis of the same hallmark gene sets. Genes are ranked on the x axis by log_2_(fold change) in expression between released and non-arrested cells. Vertical bars represent individual genes within each gene set; the enrichment score is plotted on the y axis. e, Heat maps of differentially expressed genes associated with glycolysis (left) and the PI3K–AKT–mTOR-pathway (continued in Extended Data Fig. 3d). Each row represents an individual sample.
We next profiled individual differentially expressed genes. Notably, arrested CD8^+^ T cells already exhibited enhanced expression of glycolysis-related and cholesterol biosynthesis-related genes compared to unstimulated cells (Fig. 2e and Extended Data Fig. 3d), indicating activation of glucose metabolism and cholesterol biosynthesis despite their non-proliferative state. In addition, transcription of glycolysis-related genes, such as Pkm, Aldoa and Mtor, and certain cholesterol synthesis-related genes, such as Fdft1, Fdps and Mvd was increased in released CD8^+^ T cells compared to non-arrested and arrested cells (Fig. 2e and Extended Data Fig. 3d). Transcripts of genes implicated in PI3K–AKT–mTOR signaling were also increased in arrested CD8^+^ T cells compared to unstimulated conditions, and many of these genes elevated to higher levels in released cells compared to non-arrested cells (Fig. 2e and Extended Data Fig. 3d). Correspondingly, expression levels of genes from the mitogen-activated protein kinase (MAPK)–c-MYC pathway, a pathway interconnected with both mTOR signaling^21^ and regulation of glucose metabolism^22^, were elevated in released cells as well (for example, Map2k1, Map2k2, Mapk3 and Myc; Extended Data Fig. 3d).
We next examined T_H_1/T_H_2-related transcripts. Il2ra, Il2rb, Ccr4 and Ccr5 were upregulated in arrested CD8^+^ T cells relative to unstimulated cells, indicating induction of a differentiation program during arrest. Expression of these transcripts further increased in non-arrested and released cells (Extended Data Fig. 3d). Il2 mRNA was highest in arrested cells, whereas Runx3 and Havcr2 (Tim3) were most highly expressed in released cells, consistent with more advanced effector differentiation. The DNA damage response (DDR) pathway was not differentially regulated, reflecting the absence of key DDR transcripts in either arrested or released cells (Extended Data Fig. 4). Together, these data indicate that temporal cell cycle inhibition of activated CD8^+^ T cells enhances expression of genes involved in glycolysis, cholesterol biosynthesis and effector differentiation.
To assess whether the transcriptional programs of the arrested and released CD8^+^ T cells resemble those of resting and reactivated memory CD8^+^ T cells, we compared our mRNA-sequencing dataset to a recently published dataset profiling lymph node and tissue-resident memory CD8^+^ T cells in both resting and reactivated states^23^. Using the same EdgeR pipeline (false discovery rate (FDR) < 0.05), we identified 1,519 overlapping differentially expressed genes (Extended Data Fig. 5). While certain genes were similarly upregulated (such as Il2) or downregulated in both arrested and reactivated cells, many changes, including those in glycolytic and effector genes (Pkm, Aldoa, Pgam1, Gapdh, Eno1, Gzmb), were shared between the released and reactivated conditions. These findings indicate that arrested CD8^+^ T cells largely mirror the transcriptional profile of resting memory T cells, whereas released CD8^+^ T cells acquire gene expression patterns characteristic of reactivated memory T cells, suggesting that memory-like features including reactivation properties are already imprinted during the arrested state.
Arrested CD8+ T cells stockpile nutrients and increase glycolysis
To complement the transcriptomic analysis and further define metabolic adaptations induced by cell cycle inhibition and release, we performed intracellular metabolite profiling of CD8^+^ T cells by mass spectrometry. Arrested CD8^+^ T cells showed elevated levels of hexose (including glucose) and several amino acids, such as glutamine and aspartate (Fig. 3a), indicating active nutrient accumulation during arrest. Released CD8^+^ T cells also exhibited increased hexose levels, but their amino acid levels were reduced compared to non-arrested cells (Fig. 3a).Fig. 3. Cell cycle-arrested CD8^+^ T cells stockpile nutrients and increase glucose metabolism.a, Heat map of differentially expressed metabolites extracted from unstimulated human CD8^+^ T cells, or ex vivo-stimulated human CD8^+^ T cells or ex vivo-stimulated mouse CD8^+^ T cells that were left untreated (non-arrested), cell cycle-arrested with HU (arrested) or released from HU-induced arrest (released; n = 3 donors). z-scores are color coded. b,c, Representative histograms (b) and gMFI (± s.e.m.; c) of PKM (n = 7), GLUT1 (n = 4), 2-NBDG (n = 4) and G6PD (n = 4) expression in unstimulated and ex vivo-stimulated human CD8^+^ T cells (HU arrested, non-arrested and released from HU arrest). Each symbol represents one healthy donor (n = 4). d, Heat map of CD98, G6PD and PKM expression in E7_49–57_-specific CD8^+^ T cells at day 7 after E7 SLP/CpG vaccination in the blood and lymph nodes (LNs) of mice treated with HU on days 1–4. Geometric mean is color coded, and marker-specific ranges are indicated (n = 6 mice per group). e, gMFI (± s.e.m.) of GLUT1 on circulating E7_49–57_-specific CD8^+^ T cells at day 7 after vaccination (n = 8 mice per group). f, Glycogen levels (mean ± s.e.m.) in unstimulated, and ex vivo-stimulated human CD8^+^ T cells (HU-arrested, non-arrested and released from HU arrest; n = 4 donors). g, Glycogen levels (mean ± s.e.m.) in HU-arrested human CD8^+^ T cells treated with WZB117 (n = 4 donors). h, Percentage of proliferating ex vivo-stimulated human CD8^+^ T cells (mean ± s.e.m.; n = 4 donors) that were either HU-arrested and subsequently released or left untreated (non-arrested), and the same conditions in which CP91149 was added during arrest or proliferation. i, Percentage of proliferating non-arrested and HU-released human CD8^+^ T cells (mean ± s.e.m., n = 5 donors) treated with WZB117. Statistical comparisons were performed using repeated-measures ANOVA with Sidak’s multiple-comparisons test (c, f and h) and two-sided unpaired (e) and paired (g and i) t-tests; P values are shown on the graphs.
The differences in intracellular glucose and amino acid levels prompted us to examine the underlying metabolic pathways. To link these changes to functional adaptations, we selected key nutrient transporters and metabolic enzymes for single-cell validation by spectral flow cytometry, focusing on molecules involved in amino acid uptake, glycolysis and the pentose phosphate pathway^24,25^. Expression of the amino acid transporter CD98 was upregulated in arrested cells and remained elevated in non-arrested and released cells, suggesting that arrested cells acquired the ability to take up and stockpile amino acids by upregulating transporter expression (Extended Data Fig. 6a,b). Expression of the glucose transporter GLUT1 was also upregulated in arrested cells, but further increased upon release, indicating enhancement of glucose metabolism. These higher levels coincided with the increased levels of PKM and ALDOA, key enzymes in glycolysis, and with enhanced uptake of the glucose analog 2-NBDG, and increased G6PD, the rate-limiting enzyme of the pentose phosphate pathway (Fig. 3b,c and Extended Data Fig. 6c). Notably, released cells exhibited the highest levels of GLUT1, PKM, ALDOA, G6PD and 2-NBDG uptake exceeding those of non-arrested cells, indicating superior glucose metabolic activity following release from arrest.
Increased PKM expression was specifically observed during the early S phase in HU-arrested cells, which displayed only low DNA content as determined by FxCycle staining (Extended Data Fig. 6d). Because HU blocks progression beyond the S phase, no cells advanced into G2/M under arrested conditions. Upon release from HU, however, cells progressed through the cell cycle and displayed elevated PKM levels in both early and late S phases as well as in G2/M. Notably, PKM expression remained low in the G0/G1 phase across arrested, non-arrested and released conditions, highlighting a cell cycle-linked regulation of PKM that is associated with DNA replication and mitotic entry. Consistent with our ex vivo findings, expression of CD98, G6PD, PKM and GLUT1 was enhanced in vaccine-elicited CD8^+^ T cells residing in blood and lymph nodes following transient cell cycle inhibition with either HU or palbociclib (Fig. 3d,e and Extended Data Fig. 6e).
As arrested cells do not undergo energy-intensive cell cycle progression yet continue to take up glucose, we interrogated whether glucose was stockpiled as glycogen rather than used for energy^26^. While unstimulated cells negligibly stored glycogen, arrested CD8^+^ T cells accumulated glycogen (Fig. 3f). This accumulation depended on glucose uptake, as GLUT1 inhibition with WZB117 prevented glycogen storage during arrest (Fig. 3g). Although non-arrested CD8^+^ T cells also stored glucose, released cells rapidly depleted their glycogen stores (Fig. 3f), consistent with their elevated proliferation and increased glycolytic activity. Restraining glycogen breakdown by selective inhibition of glycogen phosphorylase^27^ using CP91149 impaired proliferation in a dose-dependent manner, indicating that cell-intrinsic glycogenolysis and glycolytic activity supports proliferation following transient cell cycle arrest (Fig. 3h). In line with this, WZB117 reduced proliferation of both non-arrested and released cells, underscoring the critical role of glucose metabolism to support proliferation (Fig. 3i). Notably, a shorter period of cell cycle arrest (12 h), permitting less time for stockpiling nutrients such as glucose, enhanced proliferation upon release but to a lesser extent (as compared to 60 h), highlighting the functional relevance of metabolic preconditioning during arrest (Extended Data Fig. 6f).
Next, we investigated the impact of cell cycle arrest on energy production in the tricarboxylic acid (TCA) cycle in mitochondria by assessing levels of SDHA and ATP5a, and mitochondrial reactive oxygen species (by MitoSOX). Despite being non-proliferative, the activity of the TCA cycle and mitochondria increased in arrested CD8^+^ T cells. Compared to non-arrested cells, released cells displayed no substantial alterations in expression of the TCA cycle-related enzymes, but mitochondrial reactive oxygen species was further enhanced, indicating increased mitochondrial activity (Fig. 4a,b).Fig. 4. Temporal cell cycle arrest of CD8^+^ T cells modulates mitochondrial activity and cholesterol metabolism.a,b, Representative histograms (a) and gMFI (± s.e.m.; b) of SDHA (n = 7 donors), ATP5a (n = 4 donors) and MitoSox Red (n = 4 donors) in unstimulated human CD8^+^ T cells or ex vivo-stimulated human CD8^+^ T cells that were left untreated (non-arrested), cell cycle-arrested with HU (arrested) or released from HU-induced arrest (released). c,d, Representative histograms (c) and gMFI (± s.e.m.; d) of CPT1a (n = 7 donors) and FDFT1 (n = 5 donors) under the same conditions. FDFT1 gMFI is indicated as fold change relative to unstimulated cells. e, Percentage (mean ± s.e.m.) of proliferating human CD8^+^ T cells that were ex vivo-stimulated (non-arrested and released after HU arrest) and treated with zaragozic acid (left graph, n = 5) or atorvastatin (right graph, n = 6) during proliferation to inhibit cholesterol biosynthesis. Lines indicate individual donors. Statistical comparisons were performed using repeated-measures ANOVA with Sidak’s multiple comparisons (b and d) and two-sided paired t-test (e); P values are shown on the graphs.
Based on our transcriptomic analysis, we next examined fatty acid metabolism and cholesterol biosynthesis. Fatty acid metabolism is linked to T cell differentiation and long-term function, whereas cholesterol biosynthesis is critical for proliferating CD8^+^ T cells by supporting membrane biogenesis and signaling^28^. BODIPY-labeled FL-C16 staining was similar between unstimulated and arrested cells (Extended Data Fig. 6g,h), suggesting no difference in uptake of palmitate fatty acids. However, arrested cells showed signs of enhanced fatty acid processing capacity compared to unstimulated cells, as CPT1a, an essential enzyme for beta oxidation of long-chain fatty acids, was increased and further elevated upon release (Fig. 4c,d). Consistent with the transcriptomic data, arrested CD8^+^ T cells also upregulated FDFT1 (squalene synthase), a key enzyme in cholesterol biosynthesis, both ex vivo and in vivo (Fig. 4c–e and Extended Data Fig. 6i). FDFT1 expression was further increased in released CD8^+^ T cells and exceeded levels observed in non-arrested cells. Restricting FDFT1 using zaragozic acid impaired the proliferation of non-arrested cells but not of released cells, which may be related to their higher FDFT1 levels (Fig. 4e). Inhibition of the rate-limiting enzyme HMG-CoA reductase with atorvastatin suppressed proliferation in both non-arrested cells and released CD8^+^ T cells (Fig. 4e).
Together, these data show that cell cycle-arrested CD8^+^ T cells display enhanced cholesterol metabolism, elevated glucose metabolism, increased mitochondrial activity and greater TCA cycle engagement. Moreover, when given sufficient time to accumulate nutrients during arrest, these cells become metabolically primed for enhanced proliferation upon release.
CD8+ T cell proliferation after cell cycle inhibition is partially mTOR independent
We next investigated the molecular mechanisms driving glucose metabolism in CD8^+^ T cells during temporal cell cycle arrest. Phosphoproteomic analysis of released and non-arrested human CD8^+^ T cells revealed clusters of phosphorylation sites linked to activated glycolysis, transcription factors, FOXK1 and FOXK2, which regulate glycolysis-related genes^29^, and activation of MAPK–c-MYC and JAK–STAT signaling (Fig. 5a). Consistent with the transcriptome data, DDR-associated phosphosites were detectable but did not exhibit the characteristic phosphorylation pattern indicative of DNA damage or replication stress, such as activation of core DDR proteins including ATM, ATR, PRKDC and CHEK1/CHEK2 and components of the FANC pathway (Extended Data Fig. 7a). Kinase phosphosite analysis revealed a coordinated cell cycle progression pattern concurrent with enhanced phosphorylation of multiple cell cycle-regulatory kinases (Extended Data Fig. 7b).Fig. 5CD8^+^ T cell proliferation after cell cycle inhibition is partially mTOR independent.a, Heat map of hierarchical clustered z-scored phosphosite intensities measured by mass spectrometry in ex vivo-stimulated human CD8^+^ T cells that were either released from HU-induced arrest or left untreated (non-arrested; n = 3 donors). Coupled z-scores are based on normalized phosphosite intensities. The number of phospho groups per site is indicated in parentheses (3P indicates three or more phospho groups). b, Immunoblot of unstimulated human CD8^+^ T cells or ex vivo-stimulated human CD8^+^ T cells that were left untreated (non-arrested), cell cycle-arrested with HU (arrested) or released from HU-induced arrest (released). FOXK1 expression was assessed in the cytosolic (C) and nuclear (N) fractions. H3K9me3 was used as the loading control. c,d, Representative histograms (c) and gMFI (± s.e.m.; d) of phosphorylated S6 (pS6) in unstimulated and ex vivo-stimulated human CD8^+^ T cells (HU-arrested, non-arrested and released from HU arrest; n = 8). e, Representative CellTrace Violet plots of ex vivo-stimulated (non-arrested and released from HU arrest) CD8^+^ T cells derived from wild-type (WT) and mTORC1-deficient (Raptor^−/−^) mice. f, Percentage of proliferating ex vivo-stimulated CD8^+^ T cells (mean ± s.e.m.) from WT (n = 3) and Raptor^−/−^ (n = 5) mice that were non-arrested or released from HU arrest. g, PKM expression (gMFI ± s.e.m.) in ex vivo-stimulated CD8^+^ T cells from WT and Raptor^−/−^ mice (n = 4) under the same conditions as in f. h, Percentage of proliferating ex vivo-stimulated mouse and human CD8^+^ T cells (mean ± s.e.m.) that were either released from HU arrest (released) or non-arrested, and treated with rapamycin either only during proliferation or during both HU arrest and release. Lines indicate individual mice or donors (n = 4). Statistical comparisons were performed using repeated-measures ANOVA with Sidak’s multiple comparisons (d, f, g and h); P values are shown on the graphs. FC, fold change.Source data
To evaluate directly whether transient cell cycle inhibition induces DNA damage, we assessed γ-H2AX expression, a marker of DNA double-strand breaks, in CD8^+^ T cells^30^. HU-arrested cells showed elevated γ-H2AX at 60 h, consistent with replication of stress-associated DNA damage caused by stalled replication forks^31^, an effect that is exacerbated by prolonged HU exposure. Upon release from HU, γ-H2AX levels were reduced, likely reflecting DNA repair. In contrast, treatment with palbociclib or ribociclib did not induce detectable DNA damage, and released cells exhibited only a modest increase in γ-H2AX expression (Extended Data Fig. 8a,b). Non-arrested cells displayed low γ-H2AX expression at 24 h, which increased after 60 h of stimulation, consistent with replication-associated stress during continuous proliferation. Together, these data show that transient cell cycle inhibition and subsequent release do not cause substantial or lasting DNA damage.
FOXK1 and FOXK2 were differentially phosphorylated in released and non-arrested cells (Fig. 5a). Phosphorylation of FOXK1 at the C-terminal sites Ser441, Thr436, Ser445, Ser472 and Ser416 was observed in released cells, while non-arrested cells showed phosphorylation of the N-terminal sites Ser213 and Ser223. In accordance with the enhanced glycolytic state, FOXK1 nuclear translocation was increased in arrested and released CD8^+^ T cells compared to non-arrested (Fig. 5b).
The nutrient-sensitive mammalian target of rapamycin complex 1 (mTORC1) signaling pathway is important for the translocation of FOXK1/FOXK2 (ref. ^32^). To determine the role of this pathway, we assessed the activity of mTOR by measuring the phosphorylation of the downstream target ribosomal protein S6 (ref. ^33^; RPS6, S6). Arrested cells showed activation of mTOR by increased levels of pS6 compared to unstimulated cells (Fig. 5c,d). Released cells, however, showed decreased levels of pS6 compared to non-arrested cells (Fig. 5c,d), a finding in agreement with the decreased RPS6 phosphorylation at Ser205 (Fig. 5a). Kinetic analysis showed that non-arrested cells remained high in pS6 levels (up to at least 120 h after stimulation), while after cell cycle arrest the released cells showed decreased levels, already noticeable 24 h after release (Extended Data Fig. 8c).
To investigate mTORC1 directly, we used CD8^+^ T cells lacking Raptor, a binding protein of mTORC1 and critical for its activity, obtained from CD8-Cre-Rptor (Raptor) mice. While non-arrested Raptor-deficient CD8^+^ T cells were substantially blocked in their proliferation, released Raptor-deficient CD8^+^ T cells still proliferated considerably (Fig. 5e,f). Notably, released Raptor-deficient CD8^+^ T cells showed higher PKM expression as non-arrested Raptor-deficient cells, indicating that after cell cycle blockade CD8^+^ T cells maintain a high glycolytic activity independent of mTOR signaling (Fig. 5g). Decreased mTORC1 dependency was further evident when CD8^+^ T cells were treated with the mTOR inhibitor rapamycin during proliferation. Proliferation of released mouse and human CD8^+^ T cells was modestly reduced (1.5-fold and 1.2-fold, respectively), whereas non-arrested cells were more sensitive to mTOR inhibition, showing 3.4-fold and 7.8-fold reductions, respectively (Fig. 5h). Rapamycin treatment during both arrest and release still allowed proliferation of mouse and human CD8^+^ T cells, with only 2.3-fold and 1.8-fold reductions, respectively. These results indicate that, while mTOR is critical for proliferation of non-arrested cells, released CD8^+^ T cells are only partially mTOR dependent, suggesting activation of alternative pathways driving cell cycle progression after transient arrest.
IL-2-mediated cell cycle progression after cell cycle arrest
To identify pathways that could potentially bypass the mTORC1 pathway, we investigated the role of the activated MAPK–c-MYC pathway, known to be implicated in the induction of T cell proliferation and glycolysis^34^. Our transcriptomic analysis showed enhanced expression of genes of the MAPK pathway, including Myc, in released cells compared to non-arrested cells (Extended Data Fig. 3d). Moreover, the phosphoproteomics analysis confirmed that MAPK–c-MYC signaling is more activated in released CD8^+^ T cells compared to non-arrested cells (Extended Data Fig. 8d). MYC inhibition during proliferation, however, only partially inhibited the proliferation (1.2-fold) of released CD8^+^ T cells (Extended Data Fig. 8e), indicating involvement of MYC-driven and MYC-independent pathways.
The partial mTORC1 and MYC independence of released cells to proliferate prompted us to assess the role of IL-2, given its importance for CD8^+^ T proliferation^2,4^, and signaling capacity via the alternate STAT5–PI3K pathway^35^. Consistent with our transcriptomic data, the percentage of IL-2-producing cells was increased in cell cycle-arrested CD8^+^ T cells as compared to unstimulated and non-arrested cells (Fig. 6a and Extended Data Fig. 9a). Moreover, the IL-2 production on a per-cell basis was enhanced in arrested cells (Fig. 6b), which coincided with high amounts of IL-2 in the supernatant (Fig. 6c and Extended Data Fig. 9b). Arrested cells also produced more IL-2 compared to released cells, indicating that IL-2 is consumed during proliferation, with production returning to levels comparable to those in non-arrested CD8^+^ T cells (Fig. 6a–c and Extended Data Fig. 9a,b). To corroborate these findings, we tracked IL-2 expression in CD8^+^ T cells from IL-2^GFP^ reporter mice. Cell cycle arrest ex vivo led to an increased frequency of GFP^hi^ CD8^+^ T cells compared to non-arrested settings, and this percentage decreased upon release from arrest (Fig. 6d,e). To determine whether the enhanced IL-2 production observed during ex vivo cell cycle arrest also occurred in vivo, we vaccinated IL-2^GFP^ reporter mice with E7 peptide in the presence or absence of HU treatment. IL-2^GFP^ expression was markedly increased in E7-specific CD8^+^ T cells during HU treatment compared to their counterparts in untreated mice or after HU withdrawal (Fig. 6f), confirming our ex vivo findings. The frequency of IFNγ-producing CD8^+^ T cells also increased during arrest but remained lower than in non-arrested or released CD8^+^ T cells (Extended Data Fig. 9c). A substantial fraction of IL-2-producing CD8^+^ T cells coexpressed TNF (Extended Data Fig. 9d,e), indicating enhanced cytokine polyfunctionality, which together with elevated autocrine IL-2 levels on a per-cell basis are hallmarks of memory T cells with superior expansion potential^2^.Fig. 6IL-2 production during cell cycle arrest drives enhanced CD8⁺ T cell proliferation.a, Percentage of IL-2-producing cells (mean ± s.e.m.) among unstimulated IFNγ^+^ mouse CD8^+^ T cells, or ex vivo-stimulated IFNγ^+^ mouse CD8^+^ T cells that were left untreated (non-arrested), arrested in the cell cycle using HU or released from HU-induced arrest (n = 5 mice). b, gMFI (± s.e.m.) of IL-2 in IL-2^+^IFNγ^+^ mouse CD8^+^ T cells under the same conditions as in a (n = 5 mice). c, IL-2 concentration (mean ± s.e.m.) in supernatants of unstimulated mouse CD8^+^ T cells, or ex vivo-stimulated mouse CD8^+^ T cells that were non-arrested, HU-arrested or released from HU-induced arrest (n = 5 mice). d, Representative flow cytometry plots of ex vivo-stimulated IL-2^GFP+^ CD8^+^ T cells from IL-2^GFP^ reporter mice under ex vivo-stimulated conditions (HU-arrested, non-arrested and released). e, Percentage of IL-2^GFP+^ CD8^+^ T cells (mean ± s.e.m.) under the same conditions as in d and in unstimulated conditions (n = 3 mice). f, IL-2^GFP^ reporter mice were vaccinated with E7 SLP/CpG and treated with HU for 4 consecutive days (days 1–4). IL-2^GFP^ expression (gMFI ± s.e.m.) was measured in E7_49–57_-specific CD8^+^ T cells from spleens at days 5 and 8 after vaccination (n = 3 mice). g, Representative histograms of CD25 expression in mouse and human CD8^+^ T cells that were unstimulated or ex vivo-stimulated and non-arrested, HU-arrested or released. h, Representative flow cytometry plots of CellTrace Violet versus CD25 expression of HU-arrested, non-arrested and released mouse and human CD8^+^ T cells ex vivo. i, Representative CellTrace Violet plots of mouse CD8^+^ T cells under the same conditions as in g, with IL-2-neutralizing antibodies (S4B6 and JES6.1) added during proliferation. j, Percentage of proliferating CD8^+^ T cells (mean ± s.e.m.) from WT and IL-2^fl/fl^ mice that were ex vivo stimulated and released from HU arrest. IL-2 was supplemented during proliferation (n = 5 WT mice, n = 4 IL-2^fl/fl^ mice). k, pSTAT5 levels (gMFI ± s.e.m.) in mouse CD8^+^ T cells under the same conditions as in i (n = 5 mice). l, Percentage of proliferating cells (left) and CD25 expression (right; gMFI ± s.e.m.) of ex vivo-stimulated human CD8^+^ T cells (non-arrested and HU-released) with or without addition of STAT5-IN-1 supplemented during proliferation (n = 3 donors). Statistical comparisons were determined by repeated-measures ANOVA with Sidak’s multiple comparisons (a–c, e, f, j and k); P values are shown on the graphs.
Consistent with enhanced IL-2 transcription, expression of cREL, a key IL-2-regulating transcription factor^36^, was substantially increased in arrested cells compared to unstimulated cells, and remained higher compared to non-arrested and released cells (Extended Data Fig. 9f). NFAT, another critical regulator of IL-2 expression^37^, was also increased in arrested cells compared to unstimulated cells, but its expression was comparable to non-arrested cells and lower than in released cells (Extended Data Fig. 9f).
Next, we assessed the capacity of CD8^+^ T cells to respond to IL-2 by examining expression of the high-affinity IL-2 receptor CD25 (IL-2Rα). Notably, a substantial fraction of the arrested cells already showed expression of CD25, indicating that IL-2 responsiveness is established during arrest (Fig. 6g,h and Extended Data Fig. 9g). While CD25 expression on non-arrested cells increased with each cell division, the faster-cycling released cells started to down-modulate CD25 proliferation, and this down-modulation was profoundly evident for human CD8^+^ T cells (Fig. 6g,h).
We then examined the extent to which enhanced IL-2 production and signaling contribute to the increased proliferation observed in released CD8^+^ T cells. Abrogation of IL-2 signaling with neutralizing antibodies (S4B6 and JES6.1) inhibited proliferation in both released and non-arrested CD8^+^ T cells (Fig. 6i), indicating a requirement for IL-2-driven proliferation. Furthermore, IL-2-deficient CD8^+^ T cells showed limited proliferation upon release, which was restored by exogenous IL-2 supplementation (Fig. 6j). IL-2 downstream signaling as determined by quantification of phosphorylated STAT5 (pSTAT5) levels was already induced in arrested CD8^+^ T cells compared to nonresponding unstimulated cells (Fig. 6k). pSTAT5 levels further increased during release in an IL-2-dependent manner to levels exceeding those in the non-arrested cells, indicating that IL-2 downstream signaling is increased after cell cycle blockade (Fig. 6k). Pharmacological inhibition of IL-2 signaling by STAT5-IN-1, a potent and selective STAT5 inhibitor (IC_50_ 47 µM) at a concentration of 50 µM or 100 µM, resulted in stronger inhibition of non-arrested than released mouse and human CD8^+^ T cells (Fig. 6l and Extended Data Fig. 9h–j). These data indicate that while both cell populations rely on IL-2 signaling, released CD8^+^ T cells exhibit stronger IL-2 signaling. Collectively, these findings demonstrate that cell cycle-arrested CD8^+^ T cells produce elevated levels of IL-2, both ex vivo and in vivo, leading to enhanced downstream IL-2 signaling and supporting of IL-2-dependent proliferation upon release from arrest.
Temporal cell cycle blockade improves immunotherapy
To evaluate the potential therapeutic relevance of our findings, we assessed the impact of transient cell cycle arrest in the immunogenic MC-38 tumor model. HU treatment induced increased expression of GLUT1, PKM, G6PD and CD98 in blood-circulating memory/effector CD8^+^ T cells of MC-38 tumor-bearing mice (Fig. 7a–c). Phenotypically, these cells exhibited high KLRG1 and CD43^1B11^ expression (Extended Data Fig. 10a,b), and these cells were also increased in the tumor, which is shown to correlate with improved tumor control^38^ (Fig. 7d).Fig. 7. Temporal cell cycle arrest synergizes with immunotherapy.a,b, Uniform manifold approximation and projection (UMAP) analysis of blood CD44^+^CD8^+^ T cells from untreated (n = 8) and HU-treated (day 4–7, n = 15) MC-38 tumor-bearing mice (day 11 after challenge). After downsampling to 40,000 cells per group, UMAP embedding was performed. a, Contour plots (blue indicates low density; red indicates high density). b, Expression overlays of CD98, GLUT1, PKM and G6PD. c, Expression levels (mean ± s.e.m.) of CD98, GLUT1, PKM and G6PD in blood-derived KLRG1^+^CD8^+^ T cells from untreated (n = 8) and HU-treated (days 4–7, n = 15) MC-38 tumor-bearing mice on day 7 and 11 after tumor challenge. d, Frequency (mean ± s.e.m.) of intratumoral KLRG1^+^CD43^1B11^^+^ CD8^+^ T cells in untreated (n = 5) and HU-treated (days 4–7, n = 6) MC-38 tumor-bearing mice at day 15 after tumor challenge. e, Percentage (mean ± s.e.m.) of M8-specific CD8^+^ T cells (left) and Ki-67 expression (gMFI, right) in blood from untreated and HU-treated (days 4–7) MC-38 tumor-bearing mice (n = 5). f, Heat map of metabolic markers and Ki-67 in M8-specific CD8^+^ T cells from lymph nodes of untreated (n = 5) and HU-treated (days 4–7, n = 6) MC-38 tumor-bearing mice. Color scale reflects geometric mean expression; individual marker ranges are indicated. g–i, GLUT1 expression in human tumor biopsy samples. g, Clinical treatment scheme. h, Representative image illustrating multiplex immunofluorescence post-treatment samples (CD8, blue; CD3, red; keratin, green; GLUT1, yellow). i, Quantification of GLUT^+^CD8^+^ T cells (as a percentage of total CD8^+^ T cells) in paired baseline (letrozole) tumor biopsy samples and post-ribociclib surgical resections, collected 3–12 days after the last ribociclib dose. Individual participants are connected by lines. Box plots show the median (center) and 25th–75th percentiles (box), whiskers extend to the minimum/maximum values, and all individual points are displayed (n = 11). j, Tumor volume (mean ± s.e.m.) over time in EG7 tumor-bearing mice receiving untreated or HU-pretreated OT-I cells, followed by vaccination with OVA SLP/CpG one day after transfer (untreated, n = 8; OT-I groups, n = 11). k, Kaplan–Meier survival plot of MC-38 tumor-bearing mice left untreated (n = 18), treated with HU (days 4–7; n = 22), treated with αPD-L1 (day 10/14/17; n = 9) or treated with a combination of HU and αPD-L1 (n = 10). l, Top, schematic of TC-1 tumor challenge with therapeutic vaccination and HU. Bottom, Kaplan–Meier survival plot of TC-1 tumor-bearing mice either untreated (n = 6) or treated with E7 SLP/CpG (n = 8), HU (n = 7) or both (n = 7 per group). Statistical analysis included a two-sided unpaired t-test (c–e), two-sided paired t-test (h), Kruskal–Wallis and Dunn’s multiple-comparisons test (j) and log-rank Mantel-Cox test (k and l); P values are shown on the graphs. TILs, tumor-infiltrating lymphocytes.
Tumor-specific CD8^+^ T cell responses, detected by reactivity to the MuLV p15E (M8) tumor antigen using major histocompatibility complex class I tetramers, increased to higher levels over time in the blood of HU-treated mice compared to non-treated mice (Fig. 7a,e). During arrest, these tumor-specific CD8^+^ T cells exhibited a Ki-67^lo^ profile, but Ki-67 expression rapidly increased upon HU withdrawal, and this correlated with increased GLUT1, PKM, G6PD and CD98 expression (Fig. 7a,e and Extended Data Fig. 10a). A similar increase in Ki-67^hi^ CD8^+^ T cells was observed in the lymph nodes after treatment (Fig. 7f). Furthermore, metabolic profiling of M8-specific CD8^+^ T cells in the lymph nodes revealed enhanced glucose uptake (GLUT1), glucose metabolism (PKM, G6PD) and cholesterol biosynthesis (FDFT1) after HU treatment compared to M8-specific CD8^+^ T cells of untreated mice (Fig. 7f).
Next, we evaluated whether transient cell cycle blockade affects CD8^+^ T cell metabolism in a clinical setting^39^. In biopsy samples from individuals with stage II/III breast cancer, the frequency of GLUT1-expressing CD8^+^ T cells increased in the majority of individuals following intermittent ribociclib treatment compared to baseline levels during letrozole monotherapy (Fig. 7g–i). To further explore therapeutic implications, we assessed the impact of transient cell cycle arrest across multiple in vivo immunotherapy models, including adoptive T cell transfer, immune checkpoint blockade and therapeutic vaccination.
To assess efficacy of transient cell cycle arrest in the context of adoptive T cell transfer, we transferred ex vivo HU-treated or untreated OT-I cells into EG7 tumor-bearing mice. While mice that did not receive OT-I cells succumbed to tumor challenge, transfer of untreated OT-I cells delayed tumor outgrowth. Notably, transfer of OT-I cells treated with HU ex vivo (60 h before transfer) resulted in complete EG7 tumor regression (Fig. 7j).
In the MC-38 model, provision of HU in vivo delayed tumor progression in a CD8^+^ T cell-dependent manner (Fig. 7k and Extended Data Fig. 10c). Furthermore, combining transient HU treatment with αPD-L1 immune checkpoint blockade led to greater inhibition of MC-38 tumor growth and prolonged survival compared to either treatment alone (Fig. 7k and Extended Data Fig. 10d). Lastly, we assessed whether transient cell cycle blockade could enhance therapeutic vaccination. Administration of HPV E7 peptide vaccines together with HU treatment substantially improved survival in tumor-bearing mice, suggesting that transient cell cycle arrest augments the antitumor capacity of vaccine-elicited CD8^+^ T cells (Fig. 7l).
Discussion
Cell cycle inhibitors are widely used in cancer therapy. We show that transient arrest of activated CD8^+^ T cells promotes highly proliferative effector cells ex vivo and in vivo. This enhanced proliferation is driven by metabolic reprogramming during arrest, when CD8^+^ T cells stockpile nutrients and rewire key pathways, acquiring an energetic state that enables rapid proliferation upon release. Arrested cells also produce elevated IL-2, which is critical for driving this post-arrest expansion.
In particular, glucose and cholesterol metabolism were enhanced after cell cycle blockade. Glycolysis is essential for proliferation and differentiation of naive T cells, as this metabolic pathway essentially provides a fast route for ATP production^40,41^. During cell cycle blockade, the intake of glucose via the glucose transporter is already increased resulting in stockpiling glucose in the form of glycogen. This, together with higher levels of PKM and ALDOA, supports enhanced proliferation after the arrest. Cholesterol biosynthesis, essential for proliferation through its role in membrane biogenesis and lipid raft-mediated signaling^28,42^, was elevated during cell cycle arrest and further increased upon release. Consistent with their higher FDFT1 expression, released cells showed greater resilience to functional inhibition, highlighting FDFT1-driven metabolic priming as a mechanism supporting robust proliferation after transient cell cycle blockade.
While our study focused on CD8^+^ T cells, it is important to consider that other immune cells and tumor cells may also undergo metabolic rewiring upon cell cycle blockade. However, a critical distinction is that CD8^+^ T cells produce substantial amounts of IL-2 during arrest, a feature not shared by most other cell types, and this cytokine appears central to their enhanced proliferative response upon release. In this respect, Munitic et al.^43^ demonstrated that discontinuous stimulation is similar to continuous stimulation in driving proliferation of naive CD4^+^ T cells, involving rapid production of IL-2 by responsive G1 T cells upon restimulation. This suggests that CD8^+^ T cells may uniquely exploit temporal arrest to stockpile nutrients, reprogram metabolism and prime for IL-2-driven expansion, whereas other cells may primarily experience growth restriction.
IL-2 signaling is linked to cell cycle progression in CD8^+^ T cells. IL-2 promotes degradation of the CDK inhibitor p27^Kip1^, leading to increased CDK2 activity and enabling progression through G1 phase. This relationship is bidirectional: IL-2 regulates CDK expression and activity^44,45^, while CDKs in turn modulate IL-2 production^46,47^. Beyond its role in cell cycle control, IL-2 also fuels metabolic programming, for example, by inducing upregulation of GLUT1 expression to support glucose uptake^48^. This establishes a synergistic feedback loop whereby metabolically primed CD8^+^ T cells upregulate IL-2 receptor expression, thereby increasing their sensitivity to IL-2 signaling. Together, these mechanisms highlight the intricate cross-talk between IL-2 signaling, cell cycle machinery and metabolic priming, which jointly may contribute to the enhanced proliferative capacity of CD8^+^ T cells following transient cell cycle arrest. However, the dual role of IL-2 in supporting both effector T cells and regulatory T cells poses a potential limitation, as IL-2-driven regulatory T cell expansion could suppress antitumor immunity. Therapeutic strategies that selectively bias IL-2 signaling toward effector T cells, such as IL-2 muteins or IL-2–antibody complexes, may help overcome this hurdle and improve clinical outcomes^49^.
The rapid expansion of effector CD8^+^ T cells following transient cell cycle blockade is central to the improved tumor control observed in synergy with immune checkpoint blockade, ACT and cancer vaccines. Previous studies have shown that CDK4/CDK6 inhibitors can promote CD8^+^ T cell immunity^50–54^. The work by Deng et al.^50^ reported that CDK6 inhibition modulated NFAT activity and its downstream targets, while Heckler et al.^54^ demonstrated a specific effect of CDK4/CDK6 inhibition on upregulation of MXD4 resulting in Myc inhibition and elevated memory formation. Additionally, CDK4/CDK6 inhibition was described to target retinoblastoma corepressor 1 (RB1)^51^, highlighting multiple underlying mechanisms. Our findings demonstrate that the beneficial effects of transient cell cycle blockade extend beyond CDK4/CDK6 inhibition and are driven by a broader metabolic reprogramming of CD8^+^ T cells during arrest.
These insights position temporal cell cycle inhibition, for example with HU or CDK4/CDK6 inhibitors, as a versatile strategy to enhance T cell function in cancer therapy. Moreover, the induction of metabolically primed CD8^+^ T cells may serve as a predictive biomarker for responses to chemoimmunotherapy.
Methods
Ethics statement
The research outlined in this study complies with all relevant ethical regulations. Animal experiments were approved by the local and national committees under the permit numbers AVD116002015271, AVD11600202013796, AVD11600202417987 and AVD1160020186804, and performed according to the recommendations and guidelines set by the Leiden University Medical Centre (LUMC) and by the Dutch Act on Animal Experimentation and EU Directive 2010/63/EU. Maximal permitted tumor sizes were not exceeded. The NEOLBC trial (NCT03283384) was conducted in accordance with the Declaration of Helsinki and approved by the Medical Ethical Committee of the LUMC.
Mice
C57BL/6J mice were obtained from Charles River (L’Arbresle, France) and Janvier labs (Le Genest-Saint-Isle, France), and maintained in the animal facility of LUMC. OT-I mice (B6.Cg-PtprcaTg(TcraTcrb)1100Mjb), IL-2^GFP^-reporter mice (B6.Il2em1Lumc; generated by the Transgenic Facility Leiden; Supplementary Fig. 2), IL-2^fl/fl^ Cre-ERT2 (ref. ^55^) and Raptor^fl/fl^ (B6.Cg-Rptortm2.1LexTg(Itgax-cre)1-1Reiz/J mice crossed in house with C57BL/6-Tg(Cd8a-cre)1Itan) mice were bred and maintained in the LUMC animal facility. All mice were housed in individual ventilated cages under specific pathogen-free conditions, and were kept on 12-h light–dark cycles and ad libitum water and chow (SDS RM3; DS801203G10R), at 20–22 °C and 45–65% humidity. In all experiments, mice were used at 6–12 weeks of age.
Ex vivo CD8+ T cell assays
Spleens from naive mice were collected, red blood cell lysis was performed, and CD8^+^ T cells were negatively enriched with magnetic beads according to the manufacturers’ instructions (BD Bioscience or Miltenyi Biotec). For all assays with human CD8^+^ T cells, buffy coats (Sanquin) from healthy donors were used. First, lymphocytes were isolated by using LeucoSep tubes (Greiner Bio-one) and Ficoll. From the lymphocyte fraction, CD8^+^ T cells were negatively enriched with magnetic beads according to the instructions of the manufacturer (Miltenyi Biotec). Enriched CD8^+^ T cells were labeled with either 5 µM CFSE (Invitrogen) or 5 µM CellTrace Violet (Thermo Fisher Scientific) and plated in a 96-well flat-bottom plate at a cell concentration of 1 × 10^5^ cells per well. Mouse CD8^+^ T cells were stimulated with 1 µg ml^−1^ plate-bound anti-CD3 (BD Biosciences, clone 145-2C11) and 2 µg ml^−1^ soluble anti-CD28 (BD Biosciences, clone 37.51). Human CD8^+^ T cells were stimulated in a flat-bottom plate with 1 µg ml^−1^ plate-bound anti-CD3 (eBioscience, clone OKT3) and 2 µg ml^−1^ Ultra-LEAF anti-CD28 (BioLegend, clone CD28.2). To obtain IL-2 deficient CD8^+^ T cells, IL-2^fl/fl^ Cre-ERT2 mice mice were treated orally with 200 mg per kg body weight tamoxifen (Merck) dissolved in corn oil (Merck), for 5 consecutive days. Three days after the final treatment, animals were euthanized and spleens were obtained and processed further like spleens from naive mice. Both mouse and human cells were stimulated in IMDM (Gibco), which was supplemented with 10% FCS (Greiner), 100 IU ml^−1^ penicillin–streptomycin (Gibco), 2 mM L-glutamine (Gibco) and 50 µM 2-mercaptoethanol at 37 °C with 5% CO_2_. One hour after stimulation, cells were treated with different cell cycle inhibitors: 250 µM HU (Sigma-Aldrich), 5 µM RO-3306 (Sigma-Aldrich), 4 µM palbociclib (SelleckChem) or 16 µM ribociclib (BioVision). To remove the cell cycle inhibitors, CD8^+^ T cells were washed using three centrifugation steps in conjunction with replenishing the medium. All inhibitors were titrated to fully inhibit the cell cycle progression of mouse and human CD8^+^ T cells after activation. Pictures were obtained using an EVOS FL Auto Imaging system (Thermo Fisher).
IL-2-neutralizing antibodies, 25 µg ml^−1^ S4B6 (BioXCell) and 25 µg ml^−1^ JES6.1 (BioXCell) were directly added after activation in non-arrested conditions or after removal of the cell cycle inhibitor in released conditions. To prevent glucose uptake, cells were incubated with 40 µm of the GLUT1 inhibitor WZB117 (MedChemExpress) dissolved in dimethylsulfoxide. To inhibit glycolysis, 1 mM 2-deoxyglucose (Sigma-Aldrich) was used. Glycogenolysis was inhibited by blocking glycogen phosphorylase with different concentrations (50 µM, 100 µM) of CP91149 (SelleckChem). Cholesterol biosynthesis was inhibited by blocking HMG-CoA reductase with 10 µM atorvastatin calcium (Sigma-Aldrich) or by blocking squalene synthase with 40 µM zaragozic acid A (Santa Cruz Biotechnology). To inhibit mTOR signaling, 250 nM rapamycin (Calbiochem) was used. MYC signaling was inhibited by 50 µM 10058-F4 (Sigma-Aldrich). STAT5 was inhibited by different concentrations of STAT5-IN-1 (MedChemExpress). Glycogen was quantified in 1 × 10⁶ ex vivo-stimulated human CD8^+^ T cells per condition using the glycogen assay kit (Abcam), following the manufacturer’s instructions. Cells were heated for 10 min at 95 °C, and optical density was measured at 570 nm using a SpectraMax i3x reader (Molecular Devices). Inhibitors were directly added after activation in non-arrested conditions, during cell cycle arrest and during release or only after removal of the cell cycle inhibitor in released conditions as indicated in figures and/or legends.
Fractionation and immunoblot
Ex vivo*-stimulated mouse CD8^+^ T cells were washed in PBS and lysed in buffer (50 mM Tris-Hcl pH 8.0, 150 mM NaCl, 5 mM MgCl_2_, 0.5% NP40, 2.5% glycerol, protease inhibitors, 10 mM N-ethylmaleimide and 10 µM MG132). Lysates were vortexed, incubated on ice for 10 min and centrifuged (10 min, 15,000g*, 4 °C) to separate cytosolic (supernatant) and nuclear (pellet) fractions. Fractions were washed and mixed with SDS sample buffer (2% SDS, 10% glycerol, 5% β-mercaptoethanol, 60 mM Tris-HCl (pH 6.8) and 0.01% bromophenol blue) before SDS–PAGE and immunoblotting. Primary antibodies used were Foxk1 (1:1,000 dilution; CST, 12025S) and H3K9me3 (1:1,000 dilution; Abcam, ab8898). The secondary antibody used was horseradish peroxidase (HRP)-conjugated anti-rabbit IgG (1:5,000 dilution; Invitrogen, G21234). Blots were imaged on an AMERSHAM Imager 600 and quantified using ImageJ.
RNA sequencing
Splenic mouse CD8^+^ T cells were isolated from ten mice and stimulated ex vivo with or without HU with three technical replicates per condition. For each replicate, live CD8^+^ T cells were subjected to fluorescence-activated cell sorting separately (BD FACSAria), and RNA was isolated using NucleoSpin XS columns (Macherey-Nagel). In the released and non-arrested states, we gated on proliferating cells, using CFSE. RNA concentrations were measured by using the Qubit 4 Fluorometer and the Qubit RNA HS Assay kit. RNA quality was determined with the Agilent 2100 Bioanalyzer by using the RNA 6000 Nano Kit.
Differentially expressed genes were selected (q < 0.05) and used for pathway analysis with IPA (version 20.0). Differential expression analysis and GSEA was performed in Qlucore Omics Explorer (version 3.7), using the trimmed mean of log expression ratios method. For GSEA, eight hallmark mouse gene sets were manually selected from the MSigDB database (v2022).
For comparison of the arrested/released CD8^+^ T cells with the reactivation program of memory CD8^+^ T cells, the datasets from Low et al.^23^ are used (Gene Expression Omnibus, accession number GSE147908).
Extraction and analysis of polar metabolites
Human CD8^+^ T cells were enriched and activated in the presence or absence of 250 µM HU according to the ex vivo experimental setup. Cells were centrifuged, washed with 75 mM ammonium carbonate and extracted with 70% ethanol preheated to 70 °C. After centrifugation (~15,400g, 10 min, 4 °C), supernatants were collected for metabolite analysis. Total ion count was calculated as the sum of all ion counts per sample.
Polar metabolites were analyzed using General Metabolics’ high-throughput, non-targeted metabolomics platform in negative ion mode. Analyses were performed on an Agilent 1260 Infinity II LC pump coupled to a Gerstel MPS autosampler (CTC Analytics) and an Agilent 6550 Series Quadrupole TOF mass spectrometer (Agilent) equipped with a Dual AJS ESI source operating in negative mode, as described previously^56^. The mobile phase consisted of isopropanol:water (60:40, vol/vol) with 1 mM ammonium fluoride at a flow rate of 150 µl min^−1^. For online mass-axis correction, two ions from the Agilent ESI-L Low Concentration Tuning Mix (G1969-85000) were used. Mass spectra were acquired in profile mode from 50–1,050 m/z with a frequency of 1.4 s for 2 × 0.48 min (double injection) at the highest resolving power (4 GHz, HiRes).
Phosphoproteomics
Samples were prepared using a previously published method^57,58^. Briefly, samples were lysed in a single pot lysis/alkylation/reduction buffer (6 M guanidine chloride (Gdmcl), 100 mM Tris (pH 8.5), 10 mM tris(2-carboxyethyl)phosphine (TCEP), 40 mM 2-chloroacetamide (CAA) and 2 µl benzonase (250 U µl^−1^) per 10 ml of lysis buffer) and transferred to a 96-well plate. Lysates were stored at −80 °C until use. Reduction/alkylation was conducted by heating the samples to 95 °C for 5 min. Proteins were precipitated with acetone, and proteolytic digestion of 500 µg protein was performed in TFE-digestion buffer by adding LysC/trypsin mix (1:25 enzyme-protein ratio) to each well at 37 °C overnight. After phosphopeptide enrichment using titanium dioxide beads and cleanup, samples were dried by vacuum centrifugation. Phosphopeptide samples were resuspended in 10 µl 0.1% formic acid.
Data-dependent acquisition mass spectrometry
Phosphopeptides were separated on a homemade analytical nano-HPLC column (50 cm × 75 μm, Reprosil-Pur C18-AQ 1.9 µm, 120 Å, Dr. Maisch) using an Ultimate 3000 nano-HPLC system (Thermo) coupled to an Exploris 480 mass spectrometer (Thermo). Peptides were loaded onto a precolumn (300 μm × 5 mm, C18 PepMap, 5 μm, 100 Å) and eluted on the analytical column with a 2–30% gradient of buffer B (80% acetonitrile, 0.1% formic acid) over 240 min at 250 nl min^−1^; buffer A was 0.1% formic acid. The column tip (~10 μm) served as the electrospray source. Mass spectrometry data were acquired in data-dependent Top20 mode with HCD (30%), MS1 resolution of 120,000 (400–1,500 m/z, 50-ms fill) and MS2 resolution of 60,000 (fill 110 ms, first mass 120 Da, quadrupole isolation 1.2 Da). Precursors with charge 2–5 were selected, dynamically excluded for 45 s (20 ppm). FAIMS was applied at −45 V, −60 V and −75 V in standard resolution mode, and a lock mass at 445.12003 m/z was used.
ELISA
To measure IL-2 concentrations in the supernatant of ex vivo-stimulated mouse CD8^+^ T cells, an ELISA was performed. MaxiSorp 96-well flat-bottom ELISA plates (Nunc) were coated with 1 µg ml^−1^ of purified anti-mouse IL-2 (clone JES6-1A12). Supernatant was loaded onto the coated plates for 2 h at 37 °C. Next, biotinylated anti-mouse IL-2 (clone XMG1.2) was incubated for 1 h at room temperature. After incubation with Streptavidin-HRP antibody (BioLegend), TMB (Sigma-Aldrich) was used to detect HRP activity. Absorbance was measured at 450 nm with an iMark microplate reader (Bio-Rad).
Cell cycle inhibition in vivo
To measure endogenous CD8^+^ T cell responses, mice were subcutaneously vaccinated in the flanks with 75 μg synthetic long HPV16 E7_43–63_ (GQAEPDRAHYNIVTFCCKCDS, produced in LUMC) and 20 μg CpG (InvivoGen). Vaccinated mice were treated intraperitoneally (i.p.) twice daily with 100 mg per kg body weight HU for 4 consecutive days, or daily with 2 mg per kg body weight topotecan (Accord), or daily with 150 mg per kg body weight palbociclib (MedChemExpress). To prevent glucose uptake, mice were once i.p. treated with 10 mg per kg body weight of WZB117 (MedChemExpress) dissolved in 10% dimethylsulfoxide/90% corn oil (MedChemExpress) or with a vehicle control, one day after vaccination or one day after HU treatment was finished. HPV E7 responses were measured in the blood at different time points by using E7_49–57_ tetramers (RAHYNIVTF). Mice were euthanized and spleens were collected, red blood cell lysis was performed, and cells were stained with different antibodies for further analysis by flow cytometry.
Tumor models
Tumor cell lines MC-38 and E.G7-OVA were cultured in IMDM (Gibco) supplemented with 10% FCS (Greiner), 100 IU ml^−1^ penicillin–streptomycin (Gibco) and 2 mM L-glutamine (Gibco). E.G7-OVA cultures were maintained with 400 µg ml^−1^ Geneticin (G418; Life Technologies). The HPV6 E6/E7-expressing TC-1 cell line (from T. C. Wu) was cultured in IMDM supplemented with MEM non-essential amino acids (Life Technologies), 1 mM sodium pyruvate (Life Technologies) and 400 µg ml^−1^ Geneticin.
For adoptive cell transfer, mice were inoculated subcutaneously in the right flanks with 1 × 10^6^ E.G7-OVA tumor cells. Nine days after tumor inoculation, cohorts of E.G7-OVA tumor-bearing mice received ex vivo HU-pretreated and untreated OT-I cells (5 × 10^4^) retro-orbitally, and were vaccinated with 150 μg synthetic long ovalbumin peptide (SMLVLLPDEVSGLEQLESIINFEKLTEWTS) and 20 μg CpG one day after transfer.
Mice were inoculated subcutaneously in the right flanks with 3 × 10^5^ MC-38. Beginning 4 days later, mice received HU (100 mg per kg body weight, i.p.) twice daily for 4 consecutive days. Anti-PD-L1 (150 µg, clone MIH-5) was administered i.p. on days 10, 14 and 17. For CD8^+^ T cell depletion, 150 µg anti-CD8 (clone 2.43) was given on day 3, and depletion was confirmed on day 4 by flow cytometry; maintenance dosing (50 µg) was performed twice weekly. Tumor growth was monitored, or mice were euthanized at defined time points for CD8^+^ T cell analysis. Before tissue collection, mice were perfused with PBS supplemented with 2 mM EDTA, after which non-tumor-draining lymph nodes and tumors were isolated. Tumors were digested with Collagenase D (1 mg ml^−1^) and DNase I (20 µg ml^−1^) for 30 min at 37 °C, and single-cell suspensions were stained for flow cytometry. MC-38-specific CD8^+^ T cells were detected using gp70/p15E major histocompatibility complex class I tetramers (KSPWFTTL).
For therapeutic vaccination, mice were inoculated subcutaneously in the right flanks with 1 × 10^5^ TC-1 tumor cells. Seven days later, when tumors were palpable, mice were vaccinated in the left flanks with 75 μg HPV16 E7_43–63_ synthetic long peptide and 20 μg CpG. HU (100 mg per kg body weight, i.p.) was administered twice daily for 4 days starting one day after vaccination. Tumors were measured at least twice weekly with calipers, and volumes were calculated as length × width × height × 0.52. Tumor growth curves and survival analyses were generated in GraphPad Prism.
Flow cytometry
Samples were incubated with TruStain FcX PLUS antibody (anti-mouse CD16/32; BioLegend) and with protein kinase inhibitor dasatinib (Sigma-Aldrich) to block nonspecific binding to Fc receptors and T cell antigen receptor downregulation, respectively. For cell surface and viability staining, cells were resuspended in staining buffer (PBS supplemented with 1% FCS) and incubated for 30 min at 4 °C with antibodies. Metabolic assays were performed after viability staining, but before cell surface staining. To determine glucose (2-NBDG) and long-chain fatty acid (BODIPY FL-C16) uptake and mitochondrial membrane potential (TMRM), mitochondrial mass (MitoTracker Deep Red) and mitochondrial-derived superoxide (MitoSox Red), cells were stained for 15 min at 37 °C in IMDM. All antibodies for metabolic enzymes and transporters, except CD98, were first conjugated to fluorescent-labeled proteins according to the manufacturer’s instructions (Abcam). Following cell surface staining, cells were permeabilized and fixed for 45 min with the eBioscience Foxp3/Transcription factor staining buffer set (Invitrogen) and incubated with antibodies for metabolic enzymes and transporters. To measure intracellular cytokines, cells were incubated for 6 h with 5 µg ml^−1^ brefeldin A (BD Pharmingen). Following cell surface staining, cells were fixed, permeabilized (according to instructions of Fix/Perm Kit of BD Biosciences) and subsequently stained intracellularly for expression of IL-2, IFNγ and TNF. For intracellular granzyme B staining, cell surface staining was performed, and cells were fixed and permeabilized with the eBioscience Foxp3/Transcription factor staining buffer set (Invitrogen). To perform phospo-protein staining, surface-stained cells were fixed with BD cytofix fixation buffer (BD Biosciences), followed by permeabilization with BD Phosflow Perm Buffer III (BD Biosciences) and pSTAT5 or pS6 antibody staining. For intracellular transcription factor staining, the True-Nuclear Transcription Factor Buffer Set (BioLegend) was used. For the analysis of the cell cycle phases, the Click-iT Plus EdU Pacific Blue Flow Cytometry Assay Kit (Thermo Fisher) was used in combination with FxCycle Violet Stain (Thermo Fisher) according to the manufacturer’s protocol. To assess PKM expression across different cell cycle phases, PKM staining was incorporated in the intracellular staining step. For the assessment of DNA damage, surface-stained cells were fixed with 4% ultrapure paraformaldehyde (Polysciences) for 15 min, permeabilized with ice-cold 100% methanol (Supelco) for 20 min, and subsequently stained for γ-H2AX (phopho-Ser139) for 1 h.
Flow cytometry experiments were performed on the BD LSRFortessa (BD Biosciences) and three-laser or five-laser Cytek Aurora spectral analyzers (Cytek Biosciences). Data were analyzed with FlowJo (Tree Star, version 10) and OMIQ (https://www.omiq.ai/) analysis software.
Clinical study
Clinical samples were obtained from participants with breast cancer enrolled in the NEOLBC trial^39^. From this randomized phase II trial, we included participants from the ribociclib plus letrozole arm. All participants in the NEOLBC study started with 2 weeks of letrozole followed by a tumor biopsy (letrozole baseline). Participants with ≥1% Ki-67 expression as scored on immunohistochemistry by central pathology review at the Department of Pathology of LUMC, were randomized between standard neoadjuvant chemotherapy or received neoadjuvant letrozole at 2.5 mg daily plus intermitted treatment with ribociclib (600 mg per day on days 1–21 of a 4-week cycle for 20 weeks for five cycles) followed by surgery. Surgical resection was performed 3–12 days after the last ribociclib dose. For the GLUT1 expression study, we analyzed paired tumor letrozole baseline biopsy samples and post-ribociclib surgical resections with a minimum of 25 CD8^+^ T cells per mm^2^.
Multispectral immunofluorescence imaging
Formalin-fixed paraffin-embedded tumor sections were stained with a multiplex immunohistochemistry protocol using Vectra (Akoya Biosciences) as described^59^. The panel included anti-pan-cytokeratin, anti-CD8α, anti-CD3ε and anti-Glut1 antibodies and DAPI. Each antibody was paired with a specific Opal fluorophore in an optimized staining sequence to maximize intensity and specificity. Image processing was performed using inForm (v2.4) and analyzed with QuPath (v0.3.1). T cells (CD3^+^) were classified as CD8^+^ or CD8^−^, and Glut1 expression was scored (Glut1^+^/Glut1^−^).
Statistical analysis and experimental design
GraphPad Prism v10.2.3 was used for all statistical analyses. Blinding was not performed for the in vivo experiments; however, for selected in vitro assays, the experimenter acquiring the data was blinded to treatment, yielding results consistent with the non-blinded experiments. The researcher responsible for staining and analyzing clinical samples was blinded to sample identity. Mice were randomized before the start of each experiment, and in tumor studies they were additionally randomized based on tumor size. No animals or data points were excluded from the analyses. Sample sizes for in vivo experiments (4–12 mice per group) were determined using G*Power or power and sample size software and approved by the institutional statistician, providing 80% power at α = 0.05. For clinical samples, normality was formally tested; for other datasets, distribution was assumed to be normal but not formally tested. Male and female animals were matched for age and sex, and cages were randomly assigned to treatment groups. Statistical parameters, including the exact n (biological replicates and number of experiments) and the statistical tests used, are reported in the figure legends. Each dot represents an individual sample, and P values are indicated in the figure panels. Data are representative of 2–3 independent experiments with similar results.
Reporting summary
Further information on research design is available in the Nature Portfolio Reporting Summary linked to this article.
Online content
Any methods, additional references, Nature Portfolio reporting summaries, source data, extended data, supplementary information, acknowledgements, peer review information; details of author contributions and competing interests; and statements of data and code availability are available at 10.1038/s41590-025-02407-0.
Supplementary information
Supplementary InformationSupplementary Figs. 1 and 2. Reporting Summary Peer Review File
Source data
Source Data Fig. 5. Unprocessed western blots.
The reference list from the paper itself. Each links out to its DOI / PubMed record.
